TA339316 DLGAP5 / DLG7 antibody

Rabbit Polyclonal Anti-DLG7 Antibody

See related secondary antibodies

Search for all "DLGAP5 / DLG7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DLGAP5 / DLG7

Product Description for DLGAP5 / DLG7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DLGAP5 / DLG7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DLGAP5 / DLG7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DAP-5, Disks large-associated protein 5, Disks large-associated protein DLG7, HURP, Hepatoma up-regulated protein, KIAA0008
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15398
Immunogen:
The immunogen for anti-DLG7 antibody: synthetic peptide directed towards the N terminal of human DLG7. Synthetic peptide located within the following region: EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG.
GeneID:
9787
Application WB
Background DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. It is a mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. DLG7 is the key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and sigling in epithelial cells.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for DLGAP5 / DLG7 (1 products)

Catalog No. Species Pres. Purity   Source  

DLGAP5 overexpression lysate

DLGAP5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn