TA339320 KIAA0020 antibody

Rabbit Polyclonal Anti-KIAA0020 Antibody

See related secondary antibodies

Search for all "KIAA0020"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit KIAA0020

Product Description for KIAA0020

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit KIAA0020.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA0020

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HBV X-transactivated gene 5 protein, HLA-HA8, KIAA0020, Minor histocompatibility antigen HA-8, Pumilio domain-containing protein KIAA0020, XTP5
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15397
Immunogen:
The immunogen for anti-KIAA0020 antibody: synthetic peptide directed towards the N terminal of human KIAA0020. Synthetic peptide located within the following region: EVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFPTRKVAKEGGPKVTSR.
GeneID:
9933
Application WB
Background KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KIAA0020 (3 products)

Catalog No. Species Pres. Purity   Source  

KIAA0020 (full length, N-term HIS tag)

KIAA0020 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

KIAA0020

KIAA0020 Human Purified
  Abnova Taiwan Corp.

KIAA0020

KIAA0020 Human Purified
  Abnova Taiwan Corp.

Positive controls for KIAA0020 (3 products)

Catalog No. Species Pres. Purity   Source  

KIAA0020 293T Cell Transient Overexpression Lysate(Denatured)

KIAA0020 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

KIAA0020 Lysate

Western Blot: KIAA0020 Lysate [NBL1-12233] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KIAA0020
  Novus Biologicals Inc.

KIAA0020 overexpression lysate

KIAA0020 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn