TA339330 IPCEF1 / PIP3-E antibody

Rabbit Polyclonal Anti-PIP3-E Antibody

See related secondary antibodies

Search for all "IPCEF1 / PIP3-E"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human IPCEF1 / PIP3-E

Product Description for IPCEF1 / PIP3-E

Rabbit anti Human IPCEF1 / PIP3-E.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IPCEF1 / PIP3-E

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Interactor protein for cytohesin exchange factors 1, KIAA0403, Phosphoinositide-binding protein PIP3-E
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WWN9
Immunogen:
The immunogen for anti-PIP3-E antibody: synthetic peptide directed towards the C terminal of human PIP3-E. Synthetic peptide located within the following region: DDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSS.
GeneID:
26034
Application WB
Background Enhances the promotion of guanine-nucleotide exchange by PSCD2 on ARF6 in a concentration-dependent manner.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IPCEF1 / PIP3-E (1 products)

Catalog No. Species Pres. Purity   Source  

IPCEF1 / PIP3-E (transcript variant 3)

IPCEF1 / PIP3-E Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for IPCEF1 / PIP3-E (2 products)

Catalog No. Species Pres. Purity   Source  

IPCEF1 Lysate

Western Blot: IPCEF1 Lysate [NBL1-14431] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IPCEF1
  Novus Biologicals Inc.

IPCEF1 overexpression lysate

IPCEF1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn