TA339333 MRTO4 antibody

Rabbit Polyclonal Anti-MRTO4 Antibody

See related secondary antibodies

Search for all "MRTO4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish MRTO4

Product Description for MRTO4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish MRTO4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MRTO4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C1orf33, MRT4, mRNA turnover protein 4 homolog
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UKD2
Immunogen:
The immunogen for anti-MRTO4 antibody: synthetic peptide directed towards the middle region of human MRTO4. Synthetic peptide located within the following region: EQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKL.
GeneID:
51154
Application WB
Background This gene encodes a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the encoded protein is currently unknown, it appears to be involved in mR turnover and ribosome assembly. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MRTO4 (4 products)

Catalog No. Species Pres. Purity   Source  

MRTO4 (1-239, His-tag)

MRTO4 Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

MRTO4 (1-239, His-tag)

MRTO4 Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

MRTO4

MRTO4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MRTO4

MRTO4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MRTO4 (1 products)

Catalog No. Species Pres. Purity   Source  

C1orf33 293T Cell Transient Overexpression Lysate(Denatured)

C1orf33 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn