TA339336 NUSAP1 / ANKT antibody

Rabbit Polyclonal Anti-NUSAP1 Antibody

See related secondary antibodies

Search for all "NUSAP1 / ANKT"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish NUSAP1 / ANKT

Product Description for NUSAP1 / ANKT

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish NUSAP1 / ANKT.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NUSAP1 / ANKT

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NuSAP, Nucleolar and spindle-associated protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BXS6
Immunogen:
The immunogen for anti-NUSAP1 antibody: synthetic peptide directed towards the C terminal of human NUSAP1. Synthetic peptide located within the following region: LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ.
GeneID:
51203
Application WB
Background NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 [PubMed 12963707]).[supplied by OMIM, Jun 2009]. Transcript Variant: This variant (7) uses an alterte in-frame splice site in the 5' coding region, compared to variant 1, resulting in an isoform (7) that is 1 aa shorter than isoform 1. ##Evidence-Data-START## Transcript exon combition :: BC012887.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NUSAP1 / ANKT (3 products)

Catalog No. Species Pres. Purity   Source  

NUSAP1 / ANKT

NUSAP1 / ANKT Human Purified
  Abnova Taiwan Corp.

NUSAP1 / ANKT

NUSAP1 / ANKT Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NUSAP1 / ANKT

NUSAP1 / ANKT Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NUSAP1 / ANKT (1 products)

Catalog No. Species Pres. Purity   Source  

NUSAP1 293T Cell Transient Overexpression Lysate(Denatured)

NUSAP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn