TA339339 MRPL39 antibody

Rabbit Polyclonal Anti-MRPL39 Antibody

See related secondary antibodies

Search for all "MRPL39"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MRPL39

Product Description for MRPL39

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MRPL39.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MRPL39

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 39S ribosomal protein L39, C21orf92, L39mt, MRP-L39, MRPL5, MSTP003, PRED22, RPML5, mitochondrial
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NYK5
Immunogen:
The immunogen for anti-MRPL39 antibody: synthetic peptide directed towards the N terminal of human MRPL39. Synthetic peptide located within the following region: TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST.
GeneID:
54148
Application WB
Background Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rR composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rR. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Two transcript variants encoding distinct isoforms have been described. A pseudogene corresponding to this gene is found on chromosome 5q. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MRPL39 (4 products)

Catalog No. Species Pres. Purity   Source  

MRPL39 (transcript variant 1)

MRPL39 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MRPL39

MRPL39 Human in vitro transl.
  Abnova Taiwan Corp.

MRPL39

MRPL39 Human in vitro transl.
  Abnova Taiwan Corp.

MRPL39

MRPL39 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MRPL39 (2 products)

Catalog No. Species Pres. Purity   Source  

MRPL39 Lysate

MRPL39 Lysate
  Novus Biologicals Inc.

MRPL39 overexpression lysate

MRPL39 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn