TA339349 NIT2 antibody

Rabbit Polyclonal Anti-NIT2 Antibody

See related secondary antibodies

Search for all "NIT2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish NIT2

Product Description for NIT2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish NIT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NIT2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Nitrilase homolog 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQR4
Immunogen:
The immunogen for anti-NIT2 antibody: synthetic peptide directed towards the middle region of human NIT2. Synthetic peptide located within the following region: VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP.
GeneID:
56954
Application WB
Background NIT2 belongs to the UPF0012 family and contains 1 CN hydrolase domain. Overexpression of NIT2 decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NIT2 (6 products)

Catalog No. Species Pres. Purity   Source  

NIT2 (1-276, His-tag)

NIT2 Human Purified > 95 % E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

NIT2 (1-276, His-tag)

NIT2 Human Purified > 95 % E. coli
50 µg / €400.00
  OriGene Technologies GmbH

NIT2

NIT2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NIT2

NIT2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NIT2

NIT2 Human Purified
  Novus Biologicals Inc.

NIT2

NIT2 Human Purified
  Novus Biologicals Inc.

Positive controls for NIT2 (1 products)

Catalog No. Species Pres. Purity   Source  

NIT2 Lysate

Western Blot: NIT2 Lysate [NBL1-13649] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NIT2
  Novus Biologicals Inc.
  • LinkedIn