TA339352 NMT1 antibody

Rabbit Polyclonal Anti-NMT1 Antibody

See related secondary antibodies

Search for all "NMT1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NMT1

Product Description for NMT1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NMT1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NMT1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Glycylpeptide N-tetradecanoyltransferase 1, NMT
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P30419
Immunogen:
The immunogen for anti-NMT1 antibody: synthetic peptide directed towards the N terminal of human NMT1. Synthetic peptide located within the following region: TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT.
GeneID:
4836
Application WB
Background Myristate, a rare 14-carbon saturated fatty acid, is cotranslatiolly attached by an amide linkage to the N-termil glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase (NMT; EC 2.3.1.97) catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the sigl-transducing guanine nucleotide-binding protein (G protein) GO (GO1; MIM 139311) (Duronio et al., 1992 [PubMed 1570339]).[supplied by OMIM, Nov 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additiol publications. ##Evidence-Data-START## Transcript exon combition :: BC006538.2, AF043324.1 [ECO:0000332] Rseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NMT1 (6 products)

Catalog No. Species Pres. Purity   Source  

NMT1

NMT1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NMT1 (1-496, His-tag)

NMT1 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

NMT1 (1-496, His-tag)

NMT1 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

NMT1

NMT1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NMT1

NMT1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NMT1

NMT1 Human
  Abnova Taiwan Corp.

Positive controls for NMT1 (3 products)

Catalog No. Species Pres. Purity   Source  

NMT1 293T Cell Transient Overexpression Lysate(Denatured)

NMT1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NMT1 Lysate

Western Blot: NMT1 Lysate [NBL1-13694] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NMT1
  Novus Biologicals Inc.

NMT1 overexpression lysate

NMT1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn