TA339356 MCCC2 antibody

Rabbit Polyclonal Anti-MCCC2 Antibody

See related secondary antibodies

Search for all "MCCC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish MCCC2

Product Description for MCCC2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish MCCC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MCCC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3-methylcrotonoyl-CoA carboxylase 2, 3-methylcrotonyl-CoA carboxylase non-biotin-containing subunit, 3-methylcrotonyl-CoA:carbon dioxide ligase subunit beta, MCCB, MCCase subunit beta, Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HCC0
Immunogen:
The immunogen for Anti-MCCC2 antibody is: synthetic peptide directed towards the C-terminal region of Human MCCC2. Synthetic peptide located within the following region: RKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIAR.
GeneID:
64087
Application WB
Background This gene encodes the small subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MCCC2 (5 products)

Catalog No. Species Pres. Purity   Source  

MCCC2

MCCC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MCCC2

MCCC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MCCC2

MCCC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MCCC2

MCCC2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MCCC2

MCCC2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MCCC2 (3 products)

Catalog No. Species Pres. Purity   Source  

MCCC2 293T Cell Transient Overexpression Lysate(Denatured)

MCCC2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MCCC2 Lysate

Western Blot: MCCC2 Lysate [NBL1-12945] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MCCC2
  Novus Biologicals Inc.

MCCC2 overexpression lysate

MCCC2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn