TA339363 XTP3TPA / DCTPP1 antibody

Rabbit Polyclonal Anti-XTP3TPA Antibody

See related secondary antibodies

Search for all "XTP3TPA / DCTPP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human XTP3TPA / DCTPP1

TA339363

More Views

  • TA339363

Product Description for XTP3TPA / DCTPP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human XTP3TPA / DCTPP1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for XTP3TPA / DCTPP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDA03, Deoxycytidine-triphosphatase 1, RS21-C6, RS21C6, XTP3-transactivated gene A protein, dCTP pyrophosphatase 1, dCTPase 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H773
Immunogen:
The immunogen for anti-XTP3TPA antibody: synthetic peptide directed towards the middle region of human XTP3TPA. Synthetic peptide located within the following region: KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST.
GeneID:
79077
Application WB
IHC
Background Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for modified dCTP. Activity is highest with 5-iodo-dCTP, followed by 5-bromo-dCTP, unmodified dCTP, 5-methyl-dCTP and 5-chloro-dCTP. Hydrolyzes 2-chloro-dATP and 2-hydroxy-dATP with lower efficiency, and has even lower activity with unmodified dATP, dTTP and dUTP (in vitro). Does not hydrolyze ATP, UTP, ITP, GTP, dADP, dCDP or dGTP. May protect D or R against the incorporation of non-canonical nucleotide triphosphates. May protect cells against ippropriate methylation of CpG islands by D methyltransferases.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for XTP3TPA / DCTPP1 (5 products)

Catalog No. Species Pres. Purity   Source  

XTP3TPA / DCTPP1

XTP3TPA / DCTPP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

XTP3TPA / DCTPP1 (1-170, His-tag)

XTP3TPA / DCTPP1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

XTP3TPA / DCTPP1 (1-170, His-tag)

XTP3TPA / DCTPP1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

XTP3TPA / DCTPP1

XTP3TPA / DCTPP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

XTP3TPA / DCTPP1

XTP3TPA / DCTPP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for XTP3TPA / DCTPP1 (3 products)

Catalog No. Species Pres. Purity   Source  

DCTPP1 overexpression lysate

DCTPP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

XTP3TPA 293T Cell Transient Overexpression Lysate(Denatured)

XTP3TPA 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

XTP3TPA Lysate

Western Blot: XTP3TPA Lysate [NBL1-17921] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DCTPP1
  Novus Biologicals Inc.
  • LinkedIn