TA339369 CDT1 antibody

Rabbit Polyclonal Anti-CDT1 Antibody

See related secondary antibodies

Search for all "CDT1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Yeast CDT1

TA339369

More Views

  • TA339369
  • TA339369

Product Description for CDT1

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Yeast CDT1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CDT1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNA replication factor Cdt1, DUB, Double parked homolog, RIS2
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt, Ye
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H211
Immunogen:
The immunogen for anti-CDT1 antibody: synthetic peptide directed towards the C terminal of human CDT1. Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ.
GeneID:
81620
Application WB
IHC
Background The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for D replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating replication at ippropriate origins. Phosphorylation of this protein by cyclin A-dependent kises results in degradation of the protein. [provided by RefSeq, Mar 2011].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CDT1 (1 products)

Catalog No. Species Pres. Purity   Source  

CDT1

CDT1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for CDT1 (2 products)

Catalog No. Species Pres. Purity   Source  

CDT1 Lysate

Western Blot: CDT1 Lysate [NBL1-09063] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CDT1.
  Novus Biologicals Inc.

CDT1 overexpression lysate

CDT1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn