TA339384 Peroxin 11A / PEX11A antibody

Rabbit Polyclonal Anti-PEX11A Antibody

See related secondary antibodies

Search for all "Peroxin 11A / PEX11A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Porcine Peroxin 11A / PEX11A

Product Description for Peroxin 11A / PEX11A

Rabbit anti Bovine, Canine, Human, Porcine Peroxin 11A / PEX11A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Peroxin 11A / PEX11A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 28 kDa peroxisomal integral membrane protein, HsPEX11p, PEX11-alpha, PMP28, Peroxin-11A, Peroxisomal biogenesis factor 11A, Peroxisomal membrane protein 11A
Presentation Purified
Reactivity Bov, Can, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75192
Immunogen:
The immunogen for anti-PEX11A antibody: synthetic peptide directed towards the middle region of human PEX11A. Synthetic peptide located within the following region: MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL.
GeneID:
8800
Application WB
Background This gene is a member of the PEX11 family, which is composed of membrane elongation factors involved in regulation of peroxisome maintence and proliferation. This gene product interacts with peroxisomal membrane protein 19 and may respond to outside stimuli to increase peroxisome abundance. Altertively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2012].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Peroxin 11A / PEX11A (4 products)

Catalog No. Species Pres. Purity   Source  

Peroxin 11A / PEX11A

Peroxin 11A / PEX11A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Peroxin 11A / PEX11A

Peroxin 11A / PEX11A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Peroxin 11A / PEX11A

Peroxin 11A / PEX11A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Peroxin 11A / PEX11A

Peroxin 11A / PEX11A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn