TA339385 IL1RL2 / IL1RRP2 antibody

Rabbit Polyclonal Anti-IL1RL2 Antibody

See related secondary antibodies

Search for all "IL1RL2 / IL1RRP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit IL1RL2 / IL1RRP2

Product Description for IL1RL2 / IL1RRP2

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit IL1RL2 / IL1RRP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IL1RL2 / IL1RRP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IL-1Rrp2, Interleukin-1 receptor-like 2, Interleukin-1 receptor-related protein 2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HB29
Immunogen:
The immunogen for anti-IL1RL2 antibody: synthetic peptide directed towards the N terminal of human IL1RL2. Synthetic peptide located within the following region: HVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVL.
GeneID:
8808
Application WB
Background The protein encoded by this gene is a member of the interleukin 1 receptor family. An experiment with transient gene expression demonstrated that this receptor was incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity. This gene and four other interleukin 1 receptor family genes, including interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 1 (IL1RL1), and interleukin 18 receptor 1 (IL18R1), form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IL1RL2 / IL1RRP2 (2 products)

Catalog No. Species Pres. Purity   Source  

IL1RL2 / IL1RRP2

IL1RL2 / IL1RRP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IL1RL2 / IL1RRP2

IL1RL2 / IL1RRP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn