TA339391 OSMR antibody

Rabbit Polyclonal Anti-OSMR Antibody

See related secondary antibodies

Search for all "OSMR"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Rabbit OSMR

Product Description for OSMR

Rabbit anti Canine, Equine, Guinea Pig, Human, Rabbit OSMR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OSMR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IL-31 receptor beta, IL-31R-beta, IL-31RB, Interleukin-31 receptor subunit beta, OSMRB, Oncostatin-M receptor beta, Oncostatin-M specific receptor subunit beta
Presentation Purified
Reactivity Can, Eq, GP, Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99650
Immunogen:
The immunogen for anti-OSMR antibody: synthetic peptide directed towards the middle region of human OSMR. Synthetic peptide located within the following region: LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH.
GeneID:
9180
Application WB
Background This gene encodes a member of the type I cytokine receptor family. The encoded protein heterodimerizes with interleukin 6 sigl transducer to form the type II oncostatin M receptor and with interleukin 31 receptor A to form the interleukin 31 receptor, and thus transduces oncostatin M and interleukin 31 induced sigling events. Mutations in this gene have been associated with familial primary localized cutaneous amyloidosis. Altertively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for OSMR (6 products)

Catalog No. Species Pres. Purity   Source  

OSMR (transcript variant 2)

OSMR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

OSMR (transcript variant 1)

OSMR Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

OSMR

OSMR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OSMR

OSMR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OSMR

OSMR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OSMR

OSMR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for OSMR (1 products)

Catalog No. Species Pres. Purity   Source  

OSMR 293T Cell Transient Overexpression Lysate(Denatured)

OSMR 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn