TA339399 PIGQ antibody

Rabbit Polyclonal Anti-PIGQ Antibody

See related secondary antibodies

Search for all "PIGQ"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PIGQ

Product Description for PIGQ

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PIGQ.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PIGQ

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms N-acetylglucosamyl transferase component GPI1, PIG-Q, Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q, Phosphatidylinositol-glycan biosynthesis class Q protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BRB3
Immunogen:
The immunogen for anti-PIGQ antibody: synthetic peptide directed towards the N terminal of human PIGQ. Synthetic peptide located within the following region: PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS.
GeneID:
9091
Application WB
Background This gene is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (Glcc) from UDP-Glcc to phosphatidylinositol (PI). Altertively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2012].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PIGQ (5 products)

Catalog No. Species Pres. Purity   Source  

PIGQ (transcript variant 1)

PIGQ Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PIGQ

PIGQ Human Purified
  Abnova Taiwan Corp.

PIGQ

PIGQ Human Purified
  Abnova Taiwan Corp.

PIGQ

PIGQ Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PIGQ

PIGQ Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PIGQ (1 products)

Catalog No. Species Pres. Purity   Source  

PIGQ overexpression lysate

PIGQ overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn