TA339403 SEMA4F antibody

Rabbit Polyclonal Anti-SEMA4F Antibody

See related secondary antibodies

Search for all "SEMA4F"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SEMA4F

TA339403

More Views

  • TA339403
  • TA339403
  • TA339403

Product Description for SEMA4F

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SEMA4F.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SEMA4F

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SEMAM, SEMAW, Sema M, Sema W, Semaphorin-4F, Semaphorin-M, Semaphorin-W
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95754-2
Immunogen:
The immunogen for anti-SEMA4F antibody: synthetic peptide directed towards the n terminal of human SEMA4F. Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL.
GeneID:
10505
Application WB
Background This gene encodes a transmembrane class IV semaphorin family protein, which plays a role in neural development. This gene may be involved in neurogenesis in prostate cancer, the development of neurofibromas, and breast cancer tumorigenesis. Altertive splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn