TA339405 PIGL antibody

Rabbit Polyclonal Anti-PIGL Antibody

See related secondary antibodies

Search for all "PIGL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PIGL

Product Description for PIGL

Rabbit anti Human PIGL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PIGL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, PIG-L, Phosphatidylinositol-glycan biosynthesis class L protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2B2
Immunogen:
The immunogen for anti-PIGL antibody: synthetic peptide directed towards the N terminal of human PIGL. Synthetic peptide located within the following region: MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP.
GeneID:
9487
Application WB
Background This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (Glcc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PIGL (5 products)

Catalog No. Species Pres. Purity   Source  

PIGL

PIGL Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PIGL

PIGL Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PIGL

PIGL Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PIGL

PIGL Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PIGL

PIGL Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PIGL (1 products)

Catalog No. Species Pres. Purity   Source  

PIGL overexpression lysate

PIGL overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn