TA339406 Cadherin-7 antibody

Rabbit Polyclonal Anti-Cdh7 Antibody

See related secondary antibodies

Search for all "Cadherin-7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Cadherin-7

Product Description for Cadherin-7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Cadherin-7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cadherin-7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDH7, CDH7L1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5DWV2
Immunogen:
The immunogen for Anti-Cdh7 antibody is: synthetic peptide directed towards the N-terminal region of Rat Cdh7. Synthetic peptide located within the following region: WNQFFVLEEYMGSDPLYVGKLHSDVDKGDGFIKYILSGEGASSIFIIDEN.
GeneID:
29162
Application WB
Background Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn