TA339418 GALNT3 antibody

Rabbit Polyclonal Anti-Galnt3 Antibody

See related secondary antibodies

Search for all "GALNT3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GALNT3

Product Description for GALNT3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GALNT3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GALNT3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GalNAc transferase 3, GalNAc-T3, Polypeptide N-acetylgalactosaminyltransferase 3, Protein-UDP acetylgalactosaminyltransferase 3, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3, pp-GaNTase 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P70419
Immunogen:
The immunogen for anti-Galnt3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKPFKITHLSPEEQKEKE.
GeneID:
14425
Application WB
Background The function remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn