TA339425 Tetraspanin-8 antibody

Rabbit Polyclonal Anti-TSPAN8 Antibody

See related secondary antibodies

Search for all "Tetraspanin-8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Mouse Tetraspanin-8

Product Description for Tetraspanin-8

Rabbit anti Guinea Pig, Human, Mouse Tetraspanin-8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tetraspanin-8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TM4SF3, TSPAN-8, TSPAN8, Transmembrane 4 superfamily member 3, Tumor-associated antigen CO-029
Presentation Purified
Reactivity GP, Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P19075
Immunogen:
The immunogen for anti-TSPAN8 antibody: synthetic peptide directed towards the middle region of human TSPAN8. Synthetic peptide located within the following region: VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG.
GeneID:
7103
Application WB
Background The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate sigl transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This gene is expressed in different carcinomas. The use of alterte polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Tetraspanin-8 (7 products)

Catalog No. Species Pres. Purity   Source  

Tetraspanin-8

Tetraspanin-8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Tetraspanin-8

Tetraspanin-8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Tetraspanin-8

Tetraspanin-8 Human Purified
  Abnova Taiwan Corp.

Tetraspanin-8

Tetraspanin-8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Tetraspanin-8

Tetraspanin-8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Tetraspanin-8

Tetraspanin-8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Tetraspanin-8

Tetraspanin-8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Tetraspanin-8 (1 products)

Catalog No. Species Pres. Purity   Source  

Tetraspanin-8 Lysate(Denatured)

Tetraspanin-8 Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn