TA339426 TM4SF4 antibody

Rabbit Polyclonal Anti-TM4SF4 Antibody

See related secondary antibodies

Search for all "TM4SF4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Porcine TM4SF4

Product Description for TM4SF4

Rabbit anti Bovine, Guinea Pig, Human, Porcine TM4SF4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TM4SF4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IL-TMP, ILTMP, Intestine and liver tetraspan membrane protein, Transmembrane 4 L6 family member 4
Presentation Purified
Reactivity Bov, GP, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P48230
Immunogen:
The immunogen for anti-TM4SF4 antibody: synthetic peptide directed towards the N terminal of human TM4SF4. Synthetic peptide located within the following region: CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG.
GeneID:
7104
Application WB
Background The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate sigl transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation.[provided by RefSeq, Mar 2011].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TM4SF4 (2 products)

Catalog No. Species Pres. Purity   Source  

TM4SF4

TM4SF4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TM4SF4

TM4SF4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TM4SF4 (2 products)

Catalog No. Species Pres. Purity   Source  

TM4SF4 Lysate

Western Blot: TM4SF4 Lysate [NBL1-16966] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TM4SF4
  Novus Biologicals Inc.

TM4SF4 overexpression lysate

TM4SF4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn