TA339428 LARGE antibody

Rabbit Polyclonal Anti-LARGE Antibody

See related secondary antibodies

Search for all "LARGE"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish LARGE

Product Description for LARGE

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish LARGE.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LARGE

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acetylglucosaminyltransferase-like 1A, Glycosyltransferase-like protein LARGE1, KIAA0609, LARGE, LARGE1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95461
Immunogen:
The immunogen for anti-LARGE antibody: synthetic peptide directed towards the middle region of human LARGE. Synthetic peptide located within the following region: AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE.
GeneID:
9215
Application WB
Background This gene, which is one of the largest in the human genome, encodes a member of the N-acetylglucosaminyltransferase gene family. It encodes a glycosyltransferase which participates in glycosylation of alpha-dystroglycan, and may carry out the synthesis of glycoprotein and glycosphingolipid sugar chains. It may also be involved in the addition of a repeated disaccharide unit. Mutations in this gene cause MDC1D, a novel form of congenital muscular dystrophy with severe mental retardation and abnormal glycosylation of alpha-dystroglycan. Altertive splicing of this gene results in two transcript variants that encode the same protein. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LARGE (2 products)

Catalog No. Species Pres. Purity   Source  

LARGE

LARGE Human Purified
  Abnova Taiwan Corp.

LARGE

LARGE Human Purified
  Abnova Taiwan Corp.
  • LinkedIn