TA339454 NUFIP1 antibody

Rabbit Polyclonal Anti-NUFIP1 Antibody

See related secondary antibodies

Search for all "NUFIP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NUFIP1

TA339454

More Views

  • TA339454
  • TA339454

Product Description for NUFIP1

Rabbit anti Human NUFIP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NUFIP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Nuclear FMRP-interacting protein 1, Nuclear fragile X mental retardation-interacting protein 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UHK0
Immunogen:
The immunogen for anti-NUFIP1 antibody: synthetic peptide directed towards the N terminal of human NUFIP1. Synthetic peptide located within the following region: GQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKNSYYPRKYDAKFTDFSL.
GeneID:
26747
Application WB
Background This gene encodes a nuclear R binding protein that contains a C2H2 zinc finger motif and a nuclear localization sigl. This protein is associated with the nuclear matrix in perichromatin fibrils and, in neurons, localizes to the cytoplasm in association with endoplasmic reticulum ribosomes. This protein interacts with the fragile X mental retardation protein (FMRP), the tumor suppressor protein BRCA1, upregulates R polymerase II transcription, and is involved in box C/D snoRNP biogenesis. A pseudogene of this gene resides on chromosome 6q12. [provided by RefSeq, Feb 2012].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NUFIP1 (2 products)

Catalog No. Species Pres. Purity   Source  

NUFIP1

NUFIP1 Human Purified
  Abnova Taiwan Corp.

NUFIP1

NUFIP1 Human Purified
  Abnova Taiwan Corp.

Positive controls for NUFIP1 (2 products)

Catalog No. Species Pres. Purity   Source  

NUFIP1 293T Cell Transient Overexpression Lysate(Denatured)

NUFIP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NUFIP1 overexpression lysate

NUFIP1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn