TA339461 ZNF225 antibody

Rabbit Polyclonal Anti-ZNF225 Antibody

See related secondary antibodies

Search for all "ZNF225"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF225

Product Description for ZNF225

Rabbit anti Human ZNF225.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF225

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 225
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UK10
Immunogen:
The immunogen for anti-ZNF225 antibody: synthetic peptide directed towards the N terminal of human ZNF225. Synthetic peptide located within the following region: QDDMPCQVDAGLSIIHVKTETSEGRTCKKSFSDVSVLDLHQQLQSREKSH.
GeneID:
7768
Application WB
Background May be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF225 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF225 overexpression lysate

ZNF225 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn