TA339462 ZNF224 antibody

Rabbit Polyclonal Anti-ZNF224 Antibody

See related secondary antibodies

Search for all "ZNF224"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF224

Product Description for ZNF224

Rabbit anti Human ZNF224.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF224

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BMZF2, Bone marrow zinc finger 2, KOX22, ZNF233, ZNF255, ZNF27, Zinc finger protein 224, Zinc finger protein 233, Zinc finger protein 255, Zinc finger protein 27, Zinc finger protein KOX22
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZL3
Immunogen:
The immunogen for anti-ZNF224 antibody: synthetic peptide directed towards the N terminal of human ZNF224. Synthetic peptide located within the following region: FSKEGDFPCQTEAGLSVIHTRQKSSQGNGYKPSFSDVSHFDFHQQLHSGE.
GeneID:
7767
Application WB
Background Matrix-assisted laser desorption ionization-time of flight alysis and examition of protein profiles from the SwissProt database revealed that the previously defined p97 repressor is ZNF224, a zinc finger protein. ZNF224, a Kruppel-like zinc finger transcription factor, is the repressor protein that specifically binds to the negative cis-element AldA-NRE and affects the AldA-NRE-mediated transcription.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF224 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF224

ZNF224 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF224

ZNF224 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF224 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF224 293T Cell Transient Overexpression Lysate(Denatured)

ZNF224 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn