TA339465 BTBD15 / ZBTB44 antibody

Rabbit Polyclonal Anti-ZBTB44 Antibody

See related secondary antibodies

Search for all "BTBD15 / ZBTB44"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BTBD15 / ZBTB44

Product Description for BTBD15 / ZBTB44

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BTBD15 / ZBTB44.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTBD15 / ZBTB44

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger and BTB domain-containing protein 44
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NCP5
Immunogen:
The immunogen for anti-ZBTB44 antibody: synthetic peptide directed towards the middle region of human ZBTB44. Synthetic peptide located within the following region: SRRKRKSYIVMSPESPVKCGTQTSSPQVLNSSASYSENRNQPVDSSLAFP.
GeneID:
29068
Application WB
Background May be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BTBD15 / ZBTB44 (3 products)

Catalog No. Species Pres. Purity   Source  

BTBD15 / ZBTB44 (full length, N-term HIS tag)

BTBD15 / ZBTB44 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

BTBD15 / ZBTB44

BTBD15 / ZBTB44 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

BTBD15 / ZBTB44

BTBD15 / ZBTB44 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for BTBD15 / ZBTB44 (3 products)

Catalog No. Species Pres. Purity   Source  

BTBD15 293T Cell Transient Overexpression Lysate(Denatured)

BTBD15 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

BTBD15 Lysate

Western Blot: BTBD15 Lysate [NBL1-17972] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZBTB44
  Novus Biologicals Inc.

ZBTB44 overexpression lysate

ZBTB44 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn