TA339471 VSX1 / RINX antibody

Rabbit Polyclonal Anti-VSX1 Antibody

See related secondary antibodies

Search for all "VSX1 / RINX"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Yeast VSX1 / RINX

Product Description for VSX1 / RINX

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Yeast VSX1 / RINX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for VSX1 / RINX

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeodomain protein RINX, Retinal inner nuclear layer homeobox protein, Visual system homeobox 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZR4
Immunogen:
The immunogen for anti-VSX1 antibody: synthetic peptide directed towards the middle region of human VSX1. Synthetic peptide located within the following region: FLPPRGPEPAAPLAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASP.
GeneID:
30813
Application WB
Background The protein encoded by this gene contains a paired-like homeodomain and binds to the core of the locus control region of the red/green visual pigment gene cluster. The encoded protein may regulate expression of the cone opsin genes early in development. Mutations in this gene can cause posterior polymorphous corneal dystrophy and keratoconus. Altertively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for VSX1 / RINX (1 products)

Catalog No. Species Pres. Purity   Source  

VSX1 / RINX (transcript variant 2)

VSX1 / RINX Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for VSX1 / RINX (3 products)

Catalog No. Species Pres. Purity   Source  

VSX1 overexpression lysate

VSX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

VSX1 overexpression lysate

VSX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

VSX1 overexpression lysate

VSX1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn