TA339475 ZNF510 antibody

Rabbit Polyclonal Anti-ZNF510 Antibody

See related secondary antibodies

Search for all "ZNF510"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Porcine ZNF510

Product Description for ZNF510

Rabbit anti Human, Porcine ZNF510.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF510

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0972, Zinc finger protein 510
Presentation Purified
Reactivity Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2H8
Immunogen:
The immunogen for anti-ZNF510 antibody: synthetic peptide directed towards the N terminal of human ZNF510. Synthetic peptide located within the following region: SEEEFSNQSHPKDYRGDDLIKQNKKIKDKHLEQAICINNKTLTTEEEKVL.
GeneID:
22869
Application WB
Background May be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF510 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF510 overexpression lysate

ZNF510 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn