TA339477 MLX-interacting protein antibody

Rabbit Polyclonal Anti-MLXIP Antibody

See related secondary antibodies

Search for all "MLX-interacting protein"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat MLX-interacting protein

Product Description for MLX-interacting protein

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat MLX-interacting protein.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MLX-interacting protein

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0867, MIR, MLXIP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HAP2
Immunogen:
The immunogen for anti-MLXIP antibody: synthetic peptide directed towards the C terminal of human MLXIP. Synthetic peptide located within the following region: ALSWLDQHCSLPILRPMVLSTLRQLSTSTSILTDPAQLPEQASKAVTRIG.
GeneID:
22877
Application WB
Background This gene encodes a protein that functions as part of a heterodimer to activate transcription. The encoded protein forms a heterodimer with Max-like protein X (MLX) and is involved in the regulation of genes in response to cellular glucose levels. [provided by RefSeq, Mar 2014].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MLX-interacting protein (2 products)

Catalog No. Species Pres. Purity   Source  

MLX-interacting protein

MLX-interacting protein Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MLX-interacting protein

MLX-interacting protein Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MLX-interacting protein (1 products)

Catalog No. Species Pres. Purity   Source  

MLXIP overexpression lysate

MLXIP overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn