TA339484 HSFX1 antibody

Rabbit Polyclonal Anti-HSFX1 Antibody

See related secondary antibodies

Search for all "HSFX1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human HSFX1

Product Description for HSFX1

Rabbit anti Human HSFX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HSFX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HSFX1, HSFX2, Heat shock transcription factor, LW-1, X-linked
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBD0
Immunogen:
The immunogen for anti-HSFX1 antibody: synthetic peptide directed towards the middle region of human HSFX1. Synthetic peptide located within the following region: QVTPQHREPAGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAGEWSE.
GeneID:
100130086
Application WB
Background The exact function of HSFX1 remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HSFX1 (3 products)

Catalog No. Species Pres. Purity   Source  

HSFX1 (full length, N-term HIS tag)

HSFX1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

HSFX1

HSFX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HSFX1

HSFX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for HSFX1 (4 products)

Catalog No. Species Pres. Purity   Source  

HSFX1 Lysate(Denatured)

HSFX1 Lysate(Denatured)
  Abnova Taiwan Corp.

HSFX1 overexpression lysate

HSFX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HSFX2 overexpression lysate

HSFX2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

LW1 Lysate

Western Blot: LW1 Lysate [NBL1-11740] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HSFX1
  Novus Biologicals Inc.
  • LinkedIn