TA339489 ZNF226 antibody

Rabbit Polyclonal Anti-ZNF226 Antibody

See related secondary antibodies

Search for all "ZNF226"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat ZNF226

Product Description for ZNF226

Rabbit anti Human, Rat ZNF226.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF226

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 226
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NYT6
Immunogen:
The immunogen for anti-ZNF226 antibody: synthetic peptide directed towards the middle region of human ZNF226. Synthetic peptide located within the following region: KGVDPIGWISHHDGHRVHKSEKSYRPNDYEKDNMKILTFDHNSMIHTGQK.
GeneID:
7769
Application WB
Background May be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF226 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF226 (full length, N-term HIS tag, transcript variant 2)

ZNF226 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF226

ZNF226 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF226

ZNF226 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn