TA339491 ZNF571 antibody

Rabbit Polyclonal Anti-ZNF571 Antibody

See related secondary antibodies

Search for all "ZNF571"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF571

Product Description for ZNF571

Rabbit anti Human ZNF571.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF571

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HSPC059, Zinc finger protein 571
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z3V5
Immunogen:
The immunogen for anti-ZNF571 antibody: synthetic peptide directed towards the N terminal of human ZNF571. Synthetic peptide located within the following region: CRQGFSYLSCLIQHEENHNIEKCSEVKKHRNTFSKKPSYIQHQRIQTGEK.
GeneID:
51276
Application WB
Background May be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF571 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF571

ZNF571 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF571

ZNF571 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF571 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF571 293T Cell Transient Overexpression Lysate(Denatured)

ZNF571 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn