TA339494 ZNF771 antibody

Rabbit Polyclonal Anti-ZNF771 Antibody

See related secondary antibodies

Search for all "ZNF771"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human ZNF771

Product Description for ZNF771

Rabbit anti Bovine, Canine, Guinea Pig, Human ZNF771.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF771

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 771
Presentation Purified
Reactivity Bov, Can, GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7L3S4
Immunogen:
The immunogen for anti-ZNF771 antibody: synthetic peptide directed towards the N terminal of human ZNF771. Synthetic peptide located within the following region: EVVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGRAFARRSTLAKHART.
GeneID:
51333
Application WB
Background May be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF771 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF771

ZNF771 Human Purified
  Abnova Taiwan Corp.

ZNF771

ZNF771 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZNF771 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF771 293T Cell Transient Overexpression Lysate(Denatured)

ZNF771 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn