TA339507 ZNF83 antibody

Rabbit Polyclonal Anti-ZNF83 Antibody

See related secondary antibodies

Search for all "ZNF83"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF83

Product Description for ZNF83

Rabbit anti Human ZNF83.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF83

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HPF1, ZNF816B, Zinc finger protein 816B, Zinc finger protein 83, Zinc finger protein HPF1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P51522
Immunogen:
The immunogen for anti-ZNF83 antibody: synthetic peptide directed towards the N terminal of human ZNF83. Synthetic peptide located within the following region: HGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSSS.
GeneID:
55769
Application WB
Background May be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF83 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF83

ZNF83 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF83

ZNF83 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF83

ZNF83 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF83

ZNF83 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF83 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF83 293T Cell Transient Overexpression Lysate(Denatured)

ZNF83 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn