TA339508 ZNF444 antibody

Rabbit Polyclonal Anti-ZNF444 Antibody

See related secondary antibodies

Search for all "ZNF444"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF444

Product Description for ZNF444

Rabbit anti Human ZNF444.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF444

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EZF2, Endothelial zinc finger protein 2, ZSCAN17, Zinc finger and SCAN domain-containing protein 17, Zinc finger protein 444
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N0Y2
Immunogen:
The immunogen for anti-ZNF444 antibody: synthetic peptide directed towards the middle region of human ZNF444. Synthetic peptide located within the following region: SSATRVPQDVTQGPGATGGKEDSGMIPLAGTAPGAEGPAPGDSQAVRPYK.
GeneID:
55311
Application WB
Background This gene encodes a zinc finger protein which activates transcription of a scavenger receptor gene involved in the degradation of acetylated low density lipoprotein (Ac-LDL) (PMID: 11978792). This gene is located in a cluster of zinc finger genes on chromosome 19 at q13.4. A pseudogene of this gene is located on chromosome 15. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF444 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF444

ZNF444 Human Purified
  Abnova Taiwan Corp.

ZNF444

ZNF444 Human Purified
  Abnova Taiwan Corp.

ZNF444

ZNF444 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF444

ZNF444 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF444 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF444 293T Cell Transient Overexpression Lysate(Denatured)

ZNF444 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn