TA339509 ZNF331 antibody

Rabbit Polyclonal Anti-ZNF331 Antibody

See related secondary antibodies

Search for all "ZNF331"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF331

Product Description for ZNF331

Rabbit anti Human ZNF331.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF331

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C2H2-like zinc finger protein rearranged in thyroid adenomas, RITA, ZNF463, Zinc finger protein 331, Zinc finger protein 463
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQX6
Immunogen:
The immunogen for anti-ZNF331 antibody: synthetic peptide directed towards the N terminal of human ZNF331. Synthetic peptide located within the following region: YENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYV.
GeneID:
55422
Application WB
Background This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptiol repressors. A pseudogene of this gene is located on chromosome 17. Multiple altertively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF331 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF331

ZNF331 Human Purified
  Abnova Taiwan Corp.

ZNF331

ZNF331 Human Purified
  Abnova Taiwan Corp.

ZNF331

ZNF331 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF331

ZNF331 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF331 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF331 293T Cell Transient Overexpression Lysate(Denatured)

ZNF331 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn