TA339510 ZNF167 antibody

Rabbit Polyclonal Anti-ZNF167 Antibody

See related secondary antibodies

Search for all "ZNF167"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat ZNF167

TA339510

More Views

  • TA339510

Product Description for ZNF167

Rabbit anti Human, Rat ZNF167.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZNF167

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZKSCAN7, ZNF448, ZNF64, Zinc finger protein 167, Zinc finger protein 448, Zinc finger protein 64, Zinc finger protein with KRAB and SCAN domains 7
Presentation Purified
Reactivity Hu, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P0L1
Immunogen:
The immunogen for anti-ZNF167 antibody: synthetic peptide directed towards the N terminal of human ZNF167. Synthetic peptide located within the following region: LGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFR.
GeneID:
55888
Application WB
IHC
Background May be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF167 (5 products)

Catalog No. Species Pres. Purity   Source  

ZNF167 (transcript variant 2)

ZNF167 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZNF167

ZNF167 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF167

ZNF167 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF167

ZNF167 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF167

ZNF167 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF167 (3 products)

Catalog No. Species Pres. Purity   Source  

ZKSCAN7 overexpression lysate

ZKSCAN7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZKSCAN7 overexpression lysate

ZKSCAN7 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ZNF167 293T Cell Transient Overexpression Lysate(Denatured)

ZNF167 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn