TA339515 PRDM9 / PFM6 antibody

Rabbit Polyclonal Anti-PRDM9 Antibody

See related secondary antibodies

Search for all "PRDM9 / PFM6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PRDM9 / PFM6

TA339515

More Views

  • TA339515
  • TA339515
  • TA339515
  • TA339515
  • TA339515
  • TA339515

Product Description for PRDM9 / PFM6

Rabbit anti Human PRDM9 / PFM6.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for PRDM9 / PFM6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Histone-lysine N-methyltransferase PRDM9, PR domain zinc finger protein 9, PR domain-containing protein 9
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQV7
Immunogen:
The immunogen for anti-PRDM9 antibody: synthetic peptide directed towards the middle region of human PRDM9. Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP.
GeneID:
56979
Application WB
IHC
Background The PR domain is a protein-protein interaction module of about 100 amino acids. PR domain-containing proteins, such as PRDM9, are often involved in transcriptiol regulation (Jiang and Huang, 2000 [PubMed 10668202]).[supplied by OMIM, Mar 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additiol publications. ##Evidence-Data-START## Transcript exon combition :: DQ388610.1, AK301776.1 [ECO:0000332] Rseq introns :: single sample supports all introns ERS025094 [ECO:0000348] ##Evidence-Data-END##
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn