TA339516 ZNF286A antibody

Rabbit Polyclonal Anti-ZNF286 Antibody

See related secondary antibodies

Search for all "ZNF286A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF286A

Product Description for ZNF286A

Rabbit anti Human ZNF286A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF286A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1874, ZNF286, Zinc finger protein 286A
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HBT8
Immunogen:
The immunogen for anti-ZNF286 antibody: synthetic peptide directed towards the N terminal of human ZNF286. Synthetic peptide located within the following region: GALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGK.
GeneID:
57335
Application WB
Background May be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF286A (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF286A overexpression lysate

ZNF286A overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn