TA339519 ZNF490 antibody

Rabbit Polyclonal Anti-ZNF490 Antibody

See related secondary antibodies

Search for all "ZNF490"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF490

Product Description for ZNF490

Rabbit anti Human ZNF490.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF490

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1198, Zinc finger protein 490
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULM2
Immunogen:
The immunogen for anti-ZNF490 antibody: synthetic peptide directed towards the N terminal of human ZNF490. Synthetic peptide located within the following region: DEHKNQGRNLRSPMVEALCENKEDCPCGKSTSQIPDLNTNLETPTGLKPC.
GeneID:
57474
Application WB
Background May be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF490 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF490

ZNF490 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF490

ZNF490 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF490 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF490 293T Cell Transient Overexpression Lysate(Denatured)

ZNF490 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF490 Lysate

Western Blot: ZNF490 Lysate [NBL1-18165] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF490
  Novus Biologicals Inc.

ZNF490 overexpression lysate

ZNF490 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn