TA339527 ZNF2 antibody

Rabbit Polyclonal Anti-ZNF2 Antibody

See related secondary antibodies

Search for all "ZNF2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF2

Product Description for ZNF2

Rabbit anti Human ZNF2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZNF661, Zinc finger protein 2, Zinc finger protein 2.2, Zinc finger protein 661
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BSG1
Immunogen:
The immunogen for anti-ZNF2 antibody: synthetic peptide directed towards the N terminal of human ZNF2. Synthetic peptide located within the following region: KFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRRRSALSREILTKERHQ.
GeneID:
7549
Application WB
Background The protein encoded by this gene belongs to the C2H2-type zinc-finger protein family. The exact function of this gene is not known, however, zinc-finger proteins are known to interact with D and function as transcription regulators. Altertively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2014].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF2 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF2 (full length, N-term HIS tag, transcript variant 1)

ZNF2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF2

ZNF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF2

ZNF2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF2 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF2 293T Cell Transient Overexpression Lysate(Denatured)

ZNF2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF2 Lysate

Western Blot: ZNF2 Lysate [NBL1-18079] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF2
  Novus Biologicals Inc.

ZNF2 overexpression lysate

ZNF2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn