TA339529 HES4 antibody

Rabbit Polyclonal Anti-HES4 Antibody

See related secondary antibodies

Search for all "HES4"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human HES4

Product Description for HES4

Rabbit anti Bovine, Human HES4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HES4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BHLHB42, Class B basic helix-loop-helix protein 42, Hairy and enhancer of split 4, Transcription factor HES-4, bHLH factor HES-4
Presentation Purified
Reactivity Bov, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HCC6
Immunogen:
The immunogen for anti-HES4 antibody: synthetic peptide directed towards the middle region of human HES4. Synthetic peptide located within the following region: GHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLA.
GeneID:
57801
Application WB
Background Transcriptiol repressor. Binds D on N-box motifs: 5'-CACG-3'.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HES4 (3 products)

Catalog No. Species Pres. Purity   Source  

HES4 (transcript variant 1)

HES4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

HES4

HES4 Human Purified
  Abnova Taiwan Corp.

HES4

HES4 Human Purified
  Abnova Taiwan Corp.

Positive controls for HES4 (2 products)

Catalog No. Species Pres. Purity   Source  

HES4 293T Cell Transient Overexpression Lysate(Denatured)

HES4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HES4 overexpression lysate

HES4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn