TA339530 CREBZF antibody

Rabbit Polyclonal Anti-CREBZF Antibody

See related secondary antibodies

Search for all "CREBZF"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CREBZF

Product Description for CREBZF

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CREBZF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CREBZF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CREB/ATF bZIP transcription factor, HCF-binding transcription factor Zhangfei, Host cell factor-binding transcription factor Zhangfei, ZF
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NS37
Immunogen:
The immunogen for anti-CREBZF antibody: synthetic peptide directed towards the C terminal of human CREBZF. Synthetic peptide located within the following region: TSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCS.
GeneID:
58487
Application WB
Background CREBZF strongly activates transcription when bound to HCFC1. CREBZF suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. It also suppresses the HCFC1-dependent transcriptiol activation by CREB3 and reduces the amount of CREB3 in the cell. It is able to down-regulate expression of some cellular genes in CREBZF-expressing cells.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CREBZF (4 products)

Catalog No. Species Pres. Purity   Source  

CREBZF (1-354, His-tag)

CREBZF Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

CREBZF (1-354, His-tag)

CREBZF Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

CREBZF

CREBZF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CREBZF

CREBZF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CREBZF (1 products)

Catalog No. Species Pres. Purity   Source  

CREBZF overexpression lysate

CREBZF overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn