TA339532 ZNF77 (N-term) antibody

Rabbit Polyclonal Anti-ZNF77 Antibody

See related secondary antibodies

Search for all "ZNF77"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF77

Product Description for ZNF77

Rabbit anti Human ZNF77.
Properties: (N-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF77

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 77
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 62 kDa (545 aa)
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15935
Immunogen:
A synthetic peptide directed towards the N-terminal region of human ZNF77
AA Sequence:
LCESNEGHQCGETLSQTANLLVHKSYPTEAKPSECTKCGKAFENRQRSHT
GeneID:
58492
Property N-term
Application Western blotting: 0.2 - 1.0 µg/ml.
Background ZNF77 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain and may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Huebner,K., (1993) Hum. Genet. 91 (3), 217-222.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF77 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF77 Lysate

Western Blot: ZNF77 Lysate [NBL1-18247] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF77
  Novus Biologicals Inc.
  • LinkedIn