TA339534 ZNF350 antibody

Rabbit Polyclonal Anti-ZNF350 Antibody

See related secondary antibodies

Search for all "ZNF350"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF350

TA339534

Product Description for ZNF350

Rabbit anti Human ZNF350.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF350

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KRAB zinc finger protein ZFQR, ZBRK1, ZFQR, Zinc finger and BRCA1-interacting protein with a KRAB domain 1, Zinc finger protein 350, Zinc finger protein ZBRK1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZX5
Immunogen:
The immunogen for anti-ZNF350 antibody: synthetic peptide directed towards the N terminal of human ZNF350. Synthetic peptide located within the following region: QFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHAN.
GeneID:
59348
Application WB
Background ZNF350 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 8 C2H2-type zinc fingers and 1 KRAB domain. ZNF350 is a transcriptiol repressor. It binds to a specific sequence, 5'-GGGxxxCAGxxxTTT-3', within GADD45 intron 3.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF350 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF350

ZNF350 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF350

ZNF350 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF350 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF350 293T Cell Transient Overexpression Lysate(Denatured)

ZNF350 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF350 overexpression lysate

ZNF350 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn