TA339543 ZNF649 antibody

Rabbit Polyclonal Anti-FLJ12644 Antibody

See related secondary antibodies

Search for all "ZNF649"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human ZNF649

Product Description for ZNF649

Rabbit anti Canine, Human ZNF649.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF649

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 649
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BS31
Immunogen:
The immunogen for anti-FLJ12644 antibody: synthetic peptide directed towards the C terminal of human FLJ12644. Synthetic peptide located within the following region: EKAYFYMSCLVKHKRIHSREKRGDSVKVENPSTASHSLSPSEHVQGKSPV.
GeneID:
65251
Application WB
Background The FLJ12644 gene encodes a protein may act as a transcriptiol repressor in mitogen-activated protein kise sigling pathway to mediate cellular functions.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF649 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF649 overexpression lysate

ZNF649 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn