TA339560 PTDSS2 antibody

Rabbit Polyclonal Anti-PTDSS2 Antibody

See related secondary antibodies

Search for all "PTDSS2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat PTDSS2

Product Description for PTDSS2

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat PTDSS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PTDSS2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PSS-2, PSS2, Phosphatidylserine synthase 2, PtdSer synthase 2, Serine-exchange enzyme II
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BVG9
Immunogen:
The immunogen for anti-PTDSS2 antibody: synthetic peptide directed towards the middle region of human PTDSS2. Synthetic peptide located within the following region: QAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGSVLALTWTVWR.
GeneID:
81490
Application WB
Background Phosphatidylserine (PS) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, PS is involved in cell sigling, blood coagulation, and apoptosis. PS is synthesized by a calcium-dependent base-exchange reaction catalyzed by PS synthases (EC 2.7.8.8), like PTDSS2, that exchange L-serine for the polar head group of phosphatidylcholine (PC) or phosphatidylethanolamine (PE) (Sturbois-Balcerzak et al., 2001 [PubMed 11084049]).
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn