TA339565 GDPD5 antibody

Rabbit Polyclonal Anti-GDPD5 Antibody

See related secondary antibodies

Search for all "GDPD5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GDPD5

Product Description for GDPD5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GDPD5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GDPD5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GDE2, Glycerophosphodiester phosphodiesterase 2, Glycerophosphodiester phosphodiesterase domain-containing protein 5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WTR4
Immunogen:
The immunogen for Anti-GDPD5 antibody is: synthetic peptide directed towards the middle region of Human GDPD5. Synthetic peptide located within the following region: VFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTLMSFRKAL.
GeneID:
81544
Application WB
Background Glycerophosphodiester phosphodiesterases, such as GDPD5, are involved in glycerol metabolism.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GDPD5 (2 products)

Catalog No. Species Pres. Purity   Source  

GDPD5

GDPD5 Human Purified
  Abnova Taiwan Corp.

GDPD5

GDPD5 Human Purified
  Abnova Taiwan Corp.

Positive controls for GDPD5 (1 products)

Catalog No. Species Pres. Purity   Source  

GDPD5 overexpression lysate

GDPD5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn