TA339569 TMEM163 antibody

Rabbit Polyclonal Anti-TMEM163 Antibody

See related secondary antibodies

Search for all "TMEM163"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TMEM163

Product Description for TMEM163

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TMEM163.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM163

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transmembrane protein 163
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TC26
Immunogen:
The immunogen for anti-TMEM163 antibody: synthetic peptide directed towards the middle region of human TMEM163. Synthetic peptide located within the following region: AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV.
GeneID:
81615
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM163 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM163

TMEM163 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TMEM163 (2 products)

Catalog No. Species Pres. Purity   Source  

TMEM163 Lysate

Western Blot: TMEM163 Lysate [NBL1-17029] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TMEM163
  Novus Biologicals Inc.

TMEM163 overexpression lysate

TMEM163 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn