TA339578 GLT8D2 / GALA4A antibody

Rabbit Polyclonal Anti-GLT8D2 Antibody

See related secondary antibodies

Search for all "GLT8D2 / GALA4A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GLT8D2 / GALA4A

Product Description for GLT8D2 / GALA4A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GLT8D2 / GALA4A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GLT8D2 / GALA4A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Glycosyltransferase 8 domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H1C3
Immunogen:
The immunogen for anti-GLT8D2 antibody: synthetic peptide directed towards the C terminal of human GLT8D2. Synthetic peptide located within the following region: IRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDP.
GeneID:
83468
Application WB
Background GLT8D2 belongs to the glycosyltransferase 8 family. The exact function of it remains unknown
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GLT8D2 / GALA4A (3 products)

Catalog No. Species Pres. Purity   Source  

GLT8D2 / GALA4A

GLT8D2 / GALA4A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GLT8D2 / GALA4A

GLT8D2 / GALA4A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GLT8D2 / GALA4A

GLT8D2 / GALA4A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for GLT8D2 / GALA4A (2 products)

Catalog No. Species Pres. Purity   Source  

GLT8D2 Lysate

Western Blot: GLT8D2 Lysate [NBL1-11127] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GLT8D2
  Novus Biologicals Inc.

GLT8D2 overexpression lysate

GLT8D2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn